PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01035652001
Common NameVIT_04s0008g03670
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family CPP
Protein Properties Length: 677aa    MW: 73858.9 Da    PI: 8.7567
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01035652001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR44.43.2e-14190227240
                TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                        +kk+CnCk+s+Clk+YCeCfa+g++C++ C+C++C+N+ 
  GSVIVT01035652001 190 KKKHCNCKNSRCLKLYCECFASGVYCNN-CHCSNCQNNV 227
                        89*************************9.********86 PP

2TCR50.73.6e-16274313140
                TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                        k++kgC+Ckks ClkkYCeCf+a+  Cse+CkC dCkN e
  GSVIVT01035652001 274 KHNKGCHCKKSGCLKKYCECFQANILCSENCKCMDCKNFE 313
                        589***********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.8E-15189229IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.188190314IPR005172CRC domain
PfamPF036387.5E-11191226IPR005172CRC domain
SMARTSM011148.4E-20274315IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.3E-12277312IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 677 aa     Download sequence    Send to blast
MSAVRSSSSS SHRQKSQKFN FKSSRGRRGE KKPRLYVSPF VSDPVQVAGV DSDHPETASD  60
ELFQIPSRAA ARGTQRHRFF ILRANEASDF PAKRQLDFTA MCRASANVIL PEHPQLPLQT  120
QPQRSQSQSQ WQLQSQSPPQ LLPPQPRPQL VPVVPRITNP SRPTLQAVKQ ESPRSLPRSN  180
SEVKDGTPKK KKHCNCKNSR CLKLYCECFA SGVYCNNCHC SNCQNNVVNE AARKEAVGST  240
LDRNPNAFRP KIANSPHGSH DGGEEAGKVP LVGKHNKGCH CKKSGCLKKY CECFQANILC  300
SENCKCMDCK NFEGSEERRA LFHDNGNYMA YIQQAANAAI SGAIGSSGYG TAVASKKRKQ  360
QVSFCTTANN QSNHRNTQFQ QDNHLRASAV SPSPSISVTH TNNAAVLGSS KFTYRSPLAD  420
ILQLQDVKDL CSLLVVVSQE AGKTLTEAER DHIETSIISS TQEREHLQTD DVQKPLPDAC  480
LSENQVERVQ TDELDQADVQ NGRLMSPGTL ALMCDEQDSI FMVRGSPDGV VGSSQIPTVK  540
SSHGQACTEV YVEQERLVLT KFWDFLNRLI TCGSIKETMC SPLAKSHTGN QQEPLEDDAT  600
KVGTGKGNHK EPNGNSIVKP SFAATTQMSQ TIAAAKGNGI AKQKPPFPAT THISQTIPAV  660
HGNGTAKPPP STNQMS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4848880.0AM484888.2 Vitis vinifera contig VV78X063253.10, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010648512.10.0PREDICTED: protein tesmin/TSO1-like CXC 6
SwissprotQ9SZD11e-143TCX5_ARATH; Protein tesmin/TSO1-like CXC 5
TrEMBLD7SUC70.0D7SUC7_VITVI; Putative uncharacterized protein
STRINGVIT_04s0008g03670.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP14691745
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.11e-116Tesmin/TSO1-like CXC domain-containing protein